DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94h and Ir7d

DIOPT Version :9

Sequence 1:NP_651148.2 Gene:Ir94h / 42769 FlyBaseID:FBgn0039080 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster


Alignment Length:479 Identity:92/479 - (19%)
Similarity:159/479 - (33%) Gaps:166/479 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 LLAESLTRYRSVRV---LIEVQDKEGSFLASQ---------ILLLCQQHS---MLNVVLYFSRWT 142
            :||..:.|..:.:|   |:.||:.|.:...::         |:||..|..   |..:..||.:..
  Fly    89 VLASKMNRKITAQVFTQLLFVQNAEQAIAIAEGVNRNGLCVIVLLTSQPERPIMTKIFTYFMQER 153

  Fly   143 RTLNVFSYLAFPYFKLLKQRLSG---------------SLRP-----------KIFINQLKDLQG 181
            ..:||.         :|..||.|               ||.|           .:|..:||:|.|
  Fly   154 YNINVV---------ILVPRLHGVQAFNVRPYTPTSCSSLEPVEIDIKDGDLWDVFPRRLKNLHG 209

  Fly   182 YKIRVQP-DLSPPNSFSYRD---RHGECQVGGFLWRIVE---NFS--------KSLKGDTQVLYP 231
            ..:.|.. |:.|....:::.   ..|...:.|.|.|||.   ||:        ..|.|.:..:..
  Fly   210 CPLSVIVWDIPPYMRINWKSSDPMDGLDGLDGLLLRIVARKMNFTLKLIPNEPNGLIGGSSFMNG 274

  Fly   232 TWAKAKVSAAEYMIQFTRNGSSDIG---VTTTMITF-KHEERYRDYSYPM-------YDISWCTM 285
            |:..|      |.:...|..:..||   .|....|| :....|...||.:       |.|....:
  Fly   275 TFTGA------YKMLRERRANITIGCAACTPERSTFLEATSPYSQMSYIIVLQARGGYSIYEVML 333

  Fly   286 LPVEKPLSVEILFSHVLSPGSALLLILAFILFFLIVPQLIKCLGITFRGRLIGMASRIFA----- 345
            .|.||  ...:|.|.:|.            |.:::        |..:|     |.|.|.|     
  Fly   334 FPFEK--YTWLLLSTILG------------LHWIV--------GSRWR-----MPSPILAGWMLW 371

  Fly   346 -LVMLCSSSAQLLSLLMSPPLHTRIKSFDDLLTSGLK---------------------------- 381
             .|:..|..|.:.:.:.:.|:....::.|..|:.|.:                            
  Fly   372 IFVIRASYEASVFNFIQNSPVKPSPRTLDQALSGGFRFITDHASYRMTLKIPSFQGKTLISAGQP 436

  Fly   382 --IFGIRSELYFLDGGFRAKYASAFHLTEN----------PNELYDNR--NYF--NTSWAYTITS 430
              :|....:..:..|.|.::...|.||..:          ..::.||.  .||  .:.:|:.|..
  Fly   437 VDVFDALLKAPWKTGAFTSRAFLADHLVRHRKHRNQLVILAEKIVDNMLCMYFPHGSYFAWEINK 501

  Fly   431 VKWNVIEAQQRHFAHPVFRYSTDL 454
            :.:|:     |.|.  :|::.:.:
  Fly   502 LLFNM-----RSFG--IFQHHSQI 518



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.