DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94h and Ir87a

DIOPT Version :9

Sequence 1:NP_651148.2 Gene:Ir94h / 42769 FlyBaseID:FBgn0039080 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster


Alignment Length:481 Identity:90/481 - (18%)
Similarity:167/481 - (34%) Gaps:141/481 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 LSGSLR---PKIFINQLKD--------LQG----YKIRVQPDLSPPNSFSYRD------------ 200
            |:.|.|   |.||.|..:.        |||    |. ...|:....:..||.|            
  Fly   336 LTASFRPWEPYIFRNSEEQPVDDYYYGLQGDEDDYN-DTSPNYGESDDESYADPGEDGDGAIPDT 399

  Fly   201 ---RHGECQVGGFLWRIVENFSKSL------KGDTQVLYPTWAKAKVSAAEYMIQFTRNGSSDIG 256
               ..|:.::.|..:.:|:..::.|      :|:...||..:.:......|.::.......|...
  Fly   400 ETQSGGKLKLSGIEYEMVQTIAERLHVSIEMQGENSNLYHLFQQLIDGEIEMIVGGIDEDPSISQ 464

  Fly   257 VTTTMITFKHEERYRDYSYPMYDISWCTMLPVEKPLSVEILFSHVLS-PGSALLLILAFILFFLI 320
            ..::.|.:..:|           ::||    |.:.......|:.|.: ...|..||..|::...:
  Fly   465 FVSSSIPYHQDE-----------LTWC----VARAKRRHGFFNFVATFNADAGFLIGIFVVTCSL 514

  Fly   321 V-------------------PQLIKCLGITFRGRLIGMA----------SRIFALVMLC----SS 352
            |                   |..::.|||     |:..|          .::|||..|.    |:
  Fly   515 VVWLAQRVSGFQLRNLNGYFPTCLRVLGI-----LLNQAIPAQDFPITLRQLFALSFLMGFFFSN 574

  Fly   353 SAQ--LLSLLMSPPLHTRIKSFDDLLTSGLKIFGIRSELYFL--DGG----FRAKYASAFHLTEN 409
            :.|  |:|.|.:|....:|.:..::.::.:.:.|....:..|  ||.    .|.|:...::|.:.
  Fly   575 TYQSFLISTLTTPRSSYQIHTLQEIYSNKMTVMGTSEHVRHLNKDGEIFKYIREKFQMCYNLVDC 639

  Fly   410 PNELYDNRNYFNTSWAYTITSVKWNVIEAQQRHFAHPVFRYSTDLCFS-SETPWGLLIA---PES 470
            .|:...|.:.              .|..::|..|.:|..:.....||. .|:.:..|:.   |:.
  Fly   640 LNDAAQNEHI--------------AVAVSRQHSFYNPRIQRDRLYCFDRRESLYVYLVTMLLPKK 690

  Fly   471 FY-----REPLQHFTLKINQAGLITQW-----MTQSFHEMVRAGRMTIKDYSRTNLMKPLRIQDL 525
            ::     ...:||    |.::|.:.:|     |.:..||.:..        .|.:..|.|.....
  Fly   691 YHLLHQINPVIQH----IIESGHMQKWARDLDMRRMIHEEITR--------VREDPFKALTFDQF 743

  Fly   526 RKCWVIFAVG-LGTSTVVFTIELLLI 550
            |.. :.|:.| |..::.||..||..:
  Fly   744 RGA-IAFSGGLLLVASCVFAFELCYV 768

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94hNP_651148.2 None
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360 9/66 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.