DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94h and Ir68a

DIOPT Version :9

Sequence 1:NP_651148.2 Gene:Ir94h / 42769 FlyBaseID:FBgn0039080 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_648455.2 Gene:Ir68a / 39269 FlyBaseID:FBgn0036150 Length:704 Species:Drosophila melanogaster


Alignment Length:245 Identity:43/245 - (17%)
Similarity:78/245 - (31%) Gaps:92/245 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 IFALVMLCSSSAQLLSLLMSPPLHTRIKSFDDLLTSGLKIFGIRSELYFLDGGFRAKYASAFHLT 407
            |:.::::.:..|...::|.:|.....|.:.:|||.|                          |:.
  Fly   479 IYCILLVATYRASFTAILANPAARVTIDTLEDLLRS--------------------------HIP 517

  Fly   408 ENPNELYDNRNYFNTSWAYTITSVKWNVIEAQQRHFAHPVFRYSTDL--------C--------- 455
            .:.... :||.:|          ::.|...|::......||.||.||        |         
  Fly   518 PSTGAT-ENRQFF----------LEANDEVARKVGEKMEVFGYSDDLTSRIAKGQCAYYDNEFYL 571

  Fly   456 ----FSSETPWGLLIAPESFYREP------------------LQHFTLKINQAGLITQWMTQSFH 498
                .:.|:...|.|..|.....|                  :||    :.:.|||.:|:..:  
  Fly   572 RYLRVADESGSALHIMKECVLYMPVVLAMEKNSALKPRVDASIQH----LAEGGLIAKWLKDA-- 630

  Fly   499 EMVRAGRMTIKDYSRTNLMKPLRIQDLRKCWVIFAVGLGTSTVVFTIELL 548
                     |:......|.:...:.:::|.|..| |.|....|:..:.||
  Fly   631 ---------IEHLPAEALAQQEALMNIQKFWSSF-VALLIGYVISMLTLL 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94hNP_651148.2 None
Ir68aNP_648455.2 Lig_chan 429..661 CDD:278489 40/234 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.