DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94h and Ir60e

DIOPT Version :9

Sequence 1:NP_651148.2 Gene:Ir94h / 42769 FlyBaseID:FBgn0039080 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_611927.3 Gene:Ir60e / 37917 FlyBaseID:FBgn0035019 Length:572 Species:Drosophila melanogaster


Alignment Length:559 Identity:111/559 - (19%)
Similarity:199/559 - (35%) Gaps:110/559 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PRTILSNHPQIIWFREETYPGLYKRHSSNLFVMACLSSTSYDGQLQLLAESLTRYRSVRVLIEVQ 111
            ||.:||::.:..  |:....|.:.  .|.|.:::.:.|........||...|.....:.::. :.
  Fly    63 PRILLSSNSREA--RDLRIRGNFT--ESTLIIVSVMDSDLNPLVASLLPRLLDELHELHIVF-LS 122

  Fly   112 DKEGSFLASQILLLCQQHSMLNVVLYFSRWTRTLNVFSYLAFPYFKLLKQRLSGSLRPKIFINQ- 175
            ::|..|....:...|.:...:||:|...:     .::|||.:|           |::|....|. 
  Fly   123 NEEPGFPKQDLYTYCFKEGFVNVILMSGK-----GLYSYLPYP-----------SIQPISLSNVS 171

  Fly   176 --------LKDLQGYKIRVQPDLSPPNSFSYRDRHGECQVGGFLWRIVENFSKSLKGDTQ-VLYP 231
                    :::.||:.:|:......|..|.|.:..|.....|:|:..|:..:.......: |..|
  Fly   172 EYFDRARIIRNFQGFPVRILRSTLAPRDFEYSNEQGGLVRAGYLFTAVKELTYRYNATIESVPIP 236

  Fly   232 TWAKAKV--SAAEYM-------IQFTRNGSSDIGVTTTMITFK------HEERYRDYSYPMYDIS 281
            ...:..|  :.||.:       :.:.::.|.::..|..:...:      |......|.|......
  Fly   237 DLPEYDVYLAVAEMLHTKKIDIVCYFKDFSLEVAYTAPLSIIREYFMAPHARPISSYLYYSKPFG 301

  Fly   282 WCTMLPVEKPLSVEILFSHVLSPGS------ALLLILAFILFFLIVPQLIKCLG---ITFRGRLI 337
            |.....|...:....:..|:.:.|:      .||..|:.||:  ...|.|:..|   :...| ::
  Fly   302 WTLWAVVISTVLYGTVMLHLAARGARVEIGKCLLYSLSHILY--NCHQKIRVAGWRDVAIHG-IL 363

  Fly   338 GMASRIFALVMLCSSSAQLLSLLMSPPLHTRIKSFDDLLTSGLKIFGIRSELY--------FLDG 394
            .:...|...|.|    |.|.|:|.|........:.:||..:...  .:..|.|        ||..
  Fly   364 TIGGFILTNVYL----ATLSSILTSGLYDEEYNTLEDLARAPYP--SLHDEYYRSQMKAKTFLPE 422

  Fly   395 GFRAKYASAFHLTENPNELYDNRNYFNTSWAYTITSVKWNVIEAQQRHFAHPVFRY--------S 451
            ..|..     .|:.|...|...|:..|.|:.|.:...:..:|..||.....|.|..        .
  Fly   423 RLRRN-----SLSLNATLLKAYRDGLNQSYIYILYEDRLELILMQQYLLKTPRFNMIRQAVGFTL 482

  Fly   452 TDLCFSSETPWGLLIAPESFYREPLQHFTLKINQAGLITQWMTQSFHEMVRAGRMTIKDYSRTNL 516
            ...|.|:..|:  |.....|.|...:|        |:..:....:|.|::..|..|        |
  Fly   483 ESYCVSNSLPY--LAMTSEFMRRLQEH--------GISIKMKADTFRELIHQGIYT--------L 529

  Fly   517 MK----PLRIQDLRK---CWVIFAVGLGTSTVVFTIELL 548
            |:    |.:..||..   .:|::.|||.:|.:||..||:
  Fly   530 MRDDEPPAKAFDLDYYFFAFVLWTVGLISSLLVFFAELV 568



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.