DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94h and Ir56b

DIOPT Version :9

Sequence 1:NP_651148.2 Gene:Ir94h / 42769 FlyBaseID:FBgn0039080 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster


Alignment Length:316 Identity:69/316 - (21%)
Similarity:127/316 - (40%) Gaps:65/316 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 YSYPMYDISWCTMLPV--EKP-----------------------LSVEILFSHVLSPGSA----- 307
            :|||:..::.|.|:|:  |.|                       :::.:.:.|...||:|     
  Fly   101 HSYPLELMTNCVMVPLAPELPKWMYMVWPLGKYIWTCLFLGTFYVALLLRYVHWREPGNATRSYT 165

  Fly   308 --LLLILAFILFFLIVPQLIKCLGITFRGRLIGMASRIFALVMLCSSSAQLLSLLMSPPLHTRIK 370
              :|..:|.::|...:...:|....:.|..:......||..::.....:.:.:..|.|.....|.
  Fly   166 RNVLHAMALLMFSANMNMSVKLKHASIRVIIFYTLLYIFGFILTNYHLSHMTAFDMKPVFLRPID 230

  Fly   371 SFDDLLTSGLKIF---GIRSELYFLDGGFRAKYASAFHLTENPNELYDNRNYFNTSWAYTITSVK 432
            ::.||:.|.|:|.   .:..||.:|. .::|..||.                 :.|:||.:|...
  Fly   231 TWSDLIHSRLRIVIHDSLLEELRWLP-VYQALLASP-----------------SRSYAYVVTQDA 277

  Fly   433 WNVIEAQQRHFAHPVFRYSTDLCFSSETPWGLL----IAPESFYREPLQHFTLKINQAGLITQWM 493
            |.....||:....|.|..| .:||.     ||.    :|..:.:.:.|..|.|.:.||||...|.
  Fly   278 WLFFNRQQKVLIQPYFHLS-KVCFG-----GLFNALPMASNASFADSLNKFILNVWQAGLWNYWE 336

  Fly   494 TQSFHEMVRAGRMTIKDYSRTNLMKPLRIQDLRKCWVIFAVGLGTSTVVFTIELLL 549
            ..:|....:||  ..|.:..|..::||.::.....|::.:.|:..|::.|.:||.:
  Fly   337 ELAFRYAEQAG--YAKVFLDTYPVEPLNLEFFTTAWIVLSAGIPISSLAFCLELFI 390



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CJJD
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.