DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94h and Ir10a

DIOPT Version :9

Sequence 1:NP_651148.2 Gene:Ir94h / 42769 FlyBaseID:FBgn0039080 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001096949.1 Gene:Ir10a / 32067 FlyBaseID:FBgn0083979 Length:609 Species:Drosophila melanogaster


Alignment Length:663 Identity:139/663 - (20%)
Similarity:238/663 - (35%) Gaps:215/663 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LYGLVLKFLVSSETTLFYFNPTGQKCSWETLPRTIL-----SNH-----PQIIWFREETYPGL-- 68
            |:.|.||.|..:........||      ..||:..|     |:|     |.:.||...|...|  
  Fly    10 LFMLDLKTLNLTRLNGLLVEPT------RDLPQLELWLRAGSDHQDAENPYVQWFLLRTEIPLSI 68

  Fly    69 --YKRH---------SSNLFVMACLSSTSYDGQLQLL-----AESLTRYRSVRVLIEVQDKEGSF 117
              |:.:         ..||.::..|.        |||     |..:.:..:...::..|||:.| 
  Fly    69 VTYQENRYWMDDPFGRRNLVLVMSLD--------QLLTNRGAAAPIQKASTFFYILADQDKDLS- 124

  Fly   118 LASQILLL---CQ----QHSMLNVVLYFSRWTRTLN-VFSYLAF-----PYFKLLKQRLSGSLRP 169
             |.:.|.|   |:    ||.:.|      |:..|.: |:.|..|     .:.:|::...|.:|..
  Fly   125 -ADEQLRLEGSCRQLWTQHKVYN------RFFLTRDGVWIYDPFKRRDSAFGRLVRYYGSETLDK 182

  Fly   170 KIFINQLKDLQGYKIRVQ--------PDLSPPNSFSYRDRHGECQVGGFLWRIVENFSKSLKGDT 226
            .:|    :|:.||.:|:|        |:.........|       |.|..:.:.:...:.|....
  Fly   183 LLF----RDMAGYPLRIQMFRSVYTRPEFDKETGLLTR-------VTGVDFLVAQMLRERLNFTM 236

  Fly   227 QVLYPTWAKAKVSAAEYMIQFTRNGS------------SDIGVTTTMITFKHEERYRDYSYPMYD 279
            .:..|        ..:|..:.:.|||            .||.:|...:.....::|.|::..:||
  Fly   237 LLQQP--------EKKYFGERSANGSYNGAIGSIIKDGLDICLTGFFVKDYLVQQYMDFTVAVYD 293

  Fly   280 ISWCTMLPVEK--PLSV--------EILFSHVLSPGSALLLILAFILFFL-----------IVPQ 323
            ...|..:|...  |.|:        :|....||:..:..|:.|...:..|           ||.|
  Fly   294 DELCIYVPKASRIPQSILPIFAVGYDIWLGFVLTAFACALIWLTLRVINLKLRIVSLGNQHIVGQ 358

  Fly   324 LIKCLGI-----------------------TFRGRLIGMASRIFALVMLCSSSAQLLSLLMSPPL 365
               .|||                       .|.|.|. :.|.||..:.    .:.|.::.:.|..
  Fly   359 ---ALGIMVDTWVVWVRLNLSHLPASYAERMFIGTLC-LVSVIFGAIF----ESSLATVYIHPLY 415

  Fly   366 HTRIKSFDDLLTSGLKIFGIRSELYFLDGGFRAKYASAFHLTENPNELYDNRNYFNTS--WAYTI 428
            :..|.:..:|..||||:      :|        ||:|          :.|:..:..||  :|...
  Fly   416 YKDINTMQELDESGLKV------VY--------KYSS----------MADDLFFSETSPLFASLN 456

  Fly   429 TSVKWN------VIE--AQQRHFAHPVFRYSTDLCFSSETPWGLL----IAPE------------ 469
            ..:.||      ||:  |:.|:.| .|.||::.:..||.  :.||    :.||            
  Fly   457 KKLSWNRDLRADVIDEVARFRNKA-GVSRYTSLILESSH--FTLLRKIWVVPECPKYYTISYVMP 518

  Fly   470 --SFYREPLQHFTLKINQAGLITQWM--TQSFHEMVRAGRMTIKDYSRTNLMKPLRIQDLRKCWV 530
              |.:.:.:....|:...||||.:|:  .:|:.::.....:...| :.:.|::.|.|.||:   :
  Fly   519 RDSPWEDAVNALLLRFLNAGLIVKWIQDEKSWVDIKMRSNILEAD-AESELVRVLTIGDLQ---L 579

  Fly   531 IFAVGLGTSTVVF 543
            .|.|.:|.:.:.|
  Fly   580 AFYVVIGGNLLAF 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94hNP_651148.2 None
Ir10aNP_001096949.1 Periplasmic_Binding_Protein_Type_2 220..>294 CDD:304360 12/81 (15%)
TM_PBP1_branched-chain-AA_like 315..>411 CDD:294309 19/103 (18%)
Lig_chan 319..587 CDD:278489 66/306 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.