DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94h and Ir94b

DIOPT Version :9

Sequence 1:NP_651148.2 Gene:Ir94h / 42769 FlyBaseID:FBgn0039080 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_732700.2 Gene:Ir94b / 318728 FlyBaseID:FBgn0051424 Length:592 Species:Drosophila melanogaster


Alignment Length:618 Identity:120/618 - (19%)
Similarity:215/618 - (34%) Gaps:134/618 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LYGLVLKFLVSSET---TLFYFN--------------------PTGQKCS---WETLPRTILSNH 54
            |:.|:|...||.||   .|.|.|                    .....||   |......|:..:
  Fly     8 LFILILSQAVSQETEFLQLKYLNNIVRSMIKLHKMETLVIVKHHLDNNCSLQNWNAHGMGIIRTN 72

  Fly    55 PQIIWFREETYPGLYKRHSSNLFVMACLSSTSYDGQLQLLAESLTRYRSVRVLIEVQDKEGSFLA 119
            .|.....::|:       :|....:.|:...|:                :.:|..|.:..|....
  Fly    73 DQGKLIMKDTF-------NSRTLAIICIGQNSH----------------ITLLRNVFETFGKVQQ 114

  Fly   120 SQILLLCQQHSMLNVVLYFSRWTRTLNVFSYLAFPYFKLLKQRLSGSLRPKIFINQLKDLQGYKI 184
            .:|:|..|...........|:.:|.|.:.:.|.          |....:.|:.|.:|........
  Fly   115 KKIILWTQMELKEKFFQEISKKSRDLKLLNLLV----------LKAVTKDKLLIYRLNPFPSPHF 169

  Fly   185 RVQPDLSPPNSFSYRDR----HGECQV--GGFLWRI----VENFSKSLKGDTQVLYPTWAKAKVS 239
            :...::..||...:.|.    ||...|  ..:.|.|    :..|..|...|.:|:        ..
  Fly   170 KRIENIWTPNDTLFMDTKFNFHGMTAVVKHDYNWTIQMGNIRKFPISRIEDKEVI--------EF 226

  Fly   240 AAEY--MIQFTRNGSS-DIGVTTTMITFKHEERYRDYSYPMYDISWCTMLPVEKPLSVEILFSHV 301
            |.:|  .:||..:... ||.:...:|...:..:..|...||...|...::|....||::.:....
  Fly   227 ALKYNLTLQFFNDVERFDIELRKRIILKSNSTQPIDSGIPMVFSSLLIVVPCGNYLSIQDVIKVS 291

  Fly   302 LSPGSALLLILAFILFFLIVPQLIKCLGIT---------------------FRG----------- 334
            ........:||.:::|.||.   |..||:|                     ||.           
  Fly   292 GIEKWIFYIILVYVIFVLIE---ITFLGVTILISRQSRHQMIPNTLVNLCAFRAILGLPFPETRR 353

  Fly   335 -----RLIGMASRIFALVMLCSSSAQLLSLLMSPPLHTRIKSFDDLLTSGLKIFGIRSELYFLDG 394
                 |.:.:|..:|.::.....:.:|.|:|.:|....::.:|::|.||||.:........|::.
  Fly   354 TSLSLRQLFLAIALFGMIFSIFINCKLSSMLTNPCPRPQVNNFEELKTSGLTVVMDHDAENFIEK 418

  Fly   395 GFRAKYASAF-------HLTENPNELYDNRNYFNTSWAYTITSVKWNVIEAQQRHFAHPVFRYST 452
            .....:.:.:       ..||....|:..:.    :.|:|:.|..:.:||:.||.........|.
  Fly   419 EIGVDFFNQYMPRKVTLTFTERAKLLFSLKG----NHAFTLFSESFAIIESYQRSKGLRAHCTSE 479

  Fly   453 DLCFSSETPWGLLIAPESFYREPLQHFTLKINQAGLITQWMTQSFHEMVRAGRMTIK-DYSRTNL 516
            ||..:...|...::...|....||:.|..::.::|:...|: ::....:....|.|. .|.|.. 
  Fly   480 DLIVAERVPRIYILENNSILDRPLRRFIRQMQESGITNHWL-KNIPSSLEKNLMQITIPYDRER- 542

  Fly   517 MKPLRIQDLRKCWVIFAVGLGTSTVVFTIELLL 549
            :.||.|:.|...|.|..:|...|.:||.:|:.|
  Fly   543 VHPLSIEHLTWLWCILILGYSISMIVFFVEMSL 575



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.