DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94g and Ir7e

DIOPT Version :9

Sequence 1:NP_651147.2 Gene:Ir94g / 42768 FlyBaseID:FBgn0039079 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001138176.1 Gene:Ir7e / 7354417 FlyBaseID:FBgn0259189 Length:608 Species:Drosophila melanogaster


Alignment Length:518 Identity:95/518 - (18%)
Similarity:186/518 - (35%) Gaps:137/518 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 MQDRDEFLVSE---VLQFCLSQDMINVN----------AIFDDFPETEN-LSSFEAYPSFEVVNQ 154
            :|.||..|..|   :..:|....:|:.:          ..:..:|..|: .|..|.    :::|:
  Fly   128 LQARDRLLQGEMRLIFDYCWRYRLIHCSIQVQKSNGDILFYSYYPFGEHGCSDMEP----QLINR 188

  Fly   155 TFTPDTQVSDLYPNKMLNLRGGVIRTMPDYSEPNTILYQDKEGNKEIL----GYLWDLLEAYAHK 215
            .........||:|.|:.|..|..:|.......|...|.:|:|   |:|    ||...||.|.|.|
  Fly   189 YNGSMLVEPDLFPRKLRNFFGCPLRCALWDVPPFLTLDEDQE---EVLRVNGGYEGRLLLALAEK 250

  Fly   216 HNAQLQVVNKYADDRPLNFIELLDAAQSGIID--VGASIQPMS-----------------MGSLS 261
            .|..:.|...:.:.|.    |.|:..:...:|  :|...|.::                 .|.|:
  Fly   251 MNFTIAVRKVHVNMRD----EALEMLRRDEVDLTLGGIRQTVARGMVATSSHNYHQTREVFGVLA 311

  Fly   262 RMHEMS------YPVNQASWCTMLPVER-----QLHVSELLTRVIPYPTLALLLLLWIFYEVLRG 315
            ..:|:|      ||.....|..:|.|..     ||.|..:|...:.......|.|:::...:|..
  Fly   312 SSYELSSFDILFYPYRLQIWMGILGVVALSALIQLIVGRMLRERMGSRFWLNLELVFVGMPLLEC 376

  Fly   316 RWRRHSRLQSIGWLVLATLVSSNYVGKLLNL--------------------FTDPPSLPPV---- 356
            .....:||..:..::...::.:.|.|.|.:|                    ||  ..|.|:    
  Fly   377 PRSHTARLYCVMLMMYTLIIRTIYQGLLYHLIRTHQLNRWPQTIESLVQKNFT--VVLTPIVQEV 439

  Fly   357 -NSLAALMESPVRIISIRSEYSAIEFTQRTKY------SAAFHLALHASILIGLRNAFNTSYGYT 414
             :.:.::.....|::...||...:.|.:....      ::|..:.:|          ||     .
  Fly   440 LDEIPSVQHMRFRLLEANSELDPLYFLEANHQLRQHVTASALDIFIH----------FN-----R 489

  Fly   415 ITSEKWKIYEEQQKRSSKPVFRYSKDLCFYEMIPFGLVIPENSPHRAPLHSY--------TLLLR 471
            ::::  |:::..::.|.          ..:|::|..::..:.:.:.|. ||:        .:.:|
  Fly   490 LSAD--KVHQRGEQGSG----------AHFEIVPEDIISMQLTMYLAK-HSFLIDQLNEEIMWMR 541

  Fly   472 QAGLHDFWVNRGFSYMVKAGKINFTAVGERYEAKTLTITDLRNVFIIYVSVLLISLILFTCEL 534
            ..||...|.....|......:.:|..:|         ..:|..:|::.:..|::.|::|..||
  Fly   542 SVGLLSVWSRWELSESYLRNEQSFQVLG---------TMELYAIFLMVLVGLIVGLLVFILEL 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94gNP_651147.2 None
Ir7eNP_001138176.1 PBPb 218..>313 CDD:214497 23/101 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.