DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94g and Ir68a

DIOPT Version :9

Sequence 1:NP_651147.2 Gene:Ir94g / 42768 FlyBaseID:FBgn0039079 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_648455.2 Gene:Ir68a / 39269 FlyBaseID:FBgn0036150 Length:704 Species:Drosophila melanogaster


Alignment Length:171 Identity:34/171 - (19%)
Similarity:56/171 - (32%) Gaps:62/171 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 KMLNLRGGVIRTMPDYSEPNTILYQDKEGNKEILGYLWDLLEAYAHKHNAQLQVVNKYADDRPLN 233
            :::|..|..:...|.|.:||.....|           |..|:..|..         .|....|..
  Fly   250 EIMNALGKALNFKPVYYKPNQTENMD-----------WTELDGGASV---------AYGSGNPDG 294

  Fly   234 FIELLDAAQSG-------IIDVGASIQPMSMGSLS------RMHEMSYPVN-------------Q 272
            :      ||:|       :.:|.|.....::|.|.      ::.|:|.|.|             .
  Fly   295 Y------AQNGTHIDSMLVDEVAAHSARFAIGDLHLFQVYLKLVELSAPHNFECLTFLTPESSTD 353

  Fly   273 ASWCT-MLPVERQLHVSELLTRVIPYPTLALLLLLWIFYEV 312
            .||.| :||....:.|..|         |:|.::..:||.:
  Fly   354 NSWQTFILPFSAGMWVGVL---------LSLFVVGTVFYAI 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94gNP_651147.2 None
Ir68aNP_648455.2 Lig_chan 429..661 CDD:278489
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.