DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94g and Ir52a

DIOPT Version :9

Sequence 1:NP_651147.2 Gene:Ir94g / 42768 FlyBaseID:FBgn0039079 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_611041.2 Gene:Ir52a / 36715 FlyBaseID:FBgn0034023 Length:599 Species:Drosophila melanogaster


Alignment Length:511 Identity:119/511 - (23%)
Similarity:230/511 - (45%) Gaps:61/511 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LLVLACLPGFHWRALLGSLARSLKYLRQARILIELMQDRDEFLVSEVLQFCLS---QDMINVNAI 130
            :|:|:|  |:.  |.....:.:|..|::.|.||.|..:      ||....|:.   ::..|:..:
  Fly    90 ILILSC--GYD--AENEENSYTLMKLQRTRRLIYLEDN------SEPESVCMRYSLKEQHNIAMV 144

  Fly   131 FDDFPETENLSSFEAYPSFEVVNQTFTPDTQVSDLYPNKMLNLRGGVIRTMPDYSEPNTILYQD- 194
            ..||.:::...|...:.:...|...|..|   ..:|.....|:||..|||:.|...|.||||:| 
  Fly   145 KSDFDQSDTFYSCRLFQTPNYVEGHFFKD---QPIYIENFQNMRGATIRTVADSLVPRTILYRDE 206

  Fly   195 KEGNKEILGYLWDLLEAYAHKHNAQLQVV--NKYADDRPLNFIELLDAAQSGIIDVGASIQPMSM 257
            |.|..:::|||..::..||.|.||:|..:  :|....:| :.:::::.....|:|:|.::  .|.
  Fly   207 KSGETKMMGYLGHMINTYAQKLNAKLHFIDTSKLGAKKP-SVLDIMNWVNEDIVDIGTAL--ASS 268

  Fly   258 GSLSRMHEMSYPVNQASWCTMLPVERQLHVSELLTRVIPYPTLALLLLLWIFYEVL-----RGRW 317
            .....|..:.||.....:|.|:||..::..:.:.:.::....|:::.::...:.||     ...|
  Fly   269 LQFKNMDSVWYPYLLTGYCLMVPVPAKMPYNLVYSMIVDPLVLSIIFVMLCLFSVLIIYTQHLSW 333

  Fly   318 R-----------------------------RHSRLQSIGWLVLATLVSSNYVGKLLNLFTDPPSL 353
            :                             :|.:|........:.::::.|...|.:.||.|||.
  Fly   334 KNLTLANILLNDKSLRGLLGQSFPFPPNPSKHLKLIIFVLCFASVMITTMYEAYLQSYFTQPPSE 398

  Fly   354 PPVNSLAALMESPVRIISIRSEYSAIEFTQRTKYS--AAFHLAL--HASILIGLRNAFNTSYGYT 414
            |.:.|...:..|.:::...|.|.:.:.....:.:.  :..||.:  ..|..:.||::||||:.:.
  Fly   399 PYIRSFRDIGNSSLKMAISRLEVNVLTSLNNSHFREISEDHLLIFDDLSEYLVLRDSFNTSFIFP 463

  Fly   415 ITSEKWKIYEEQQKRSSKPVFRYSKDLCFYEMIPFGLVIPENSPHRAPLHSYTLLLRQAGLHDFW 479
            ::.::|..||||||..::|.|..:.:|||.:.:.|...:....|||.....:.:...:.||..||
  Fly   464 VSVDRWNGYEEQQKLFAEPAFYLATNLCFNQFMLFSPPLRRYLPHRHLFEDHMMRQHEFGLVTFW 528

  Fly   480 VNRGFSYMVKAGKINFTAVG-ERYEAKTLTITDLRNVFIIYVSVLLISLILFTCEL 534
            .::.|..||:.|..:...:. :|.|..:|.:.|:..:..:|:..:.||...|..|:
  Fly   529 KSQSFIEMVRLGLASMEDLSRKRNEEVSLLLDDISWILKLYLGAMFISSFCFILEI 584



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C043
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.