DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94g and Ir7b

DIOPT Version :9

Sequence 1:NP_651147.2 Gene:Ir94g / 42768 FlyBaseID:FBgn0039079 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_572410.2 Gene:Ir7b / 31690 FlyBaseID:FBgn0029965 Length:655 Species:Drosophila melanogaster


Alignment Length:593 Identity:115/593 - (19%)
Similarity:196/593 - (33%) Gaps:185/593 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VLACLPGFHWRALLGSLARSLKYLRQARILIELMQDRDEFLVSEVLQFCLSQDMINVNAIFDDFP 135
            |||.:.|....:.:.:..|:.:.|....|.:.:..|.....:...|:|.....::||..:..  |
  Fly    95 VLALVDGLPSLSAIYARIRATQDLSHTLIYMSMPTDAYGEEMQATLRFLWRLSVLNVGVVLR--P 157

  Fly   136 ETENLSSFEAYP----------SFEVVN--QTFTPDTQVSDLYPNKMLNLRGGVIRTMPDYSEPN 188
            ..:::.....:|          |..|||  |..|......|.:|:|:.|..|.:: |...:.:..
  Fly   158 PGDHILMVSYFPFSALHGCQVISANVVNRYQVGTKRWASQDYFPSKLGNFYGCLL-TCATWEDMP 221

  Fly   189 TILYQDKEGNKEILGYLWDLLEAYAHKHN--AQLQVVNKYA-----DDRPLNFIELL----DAAQ 242
            .:::: .:|:...:|....||:..|...|  ..|..:||..     |:....|.|:.    |.:.
  Fly   222 YLVWR-PDGSGSFVGIEGALLQFMAENLNFTVGLYWMNKEEVLATFDESGRIFDEIFGHHADFSL 285

  Fly   243 SGI---IDVGASIQPMS----------------MGSLSRMHEMSYPVNQASWCTMLPVERQLHVS 288
            .|.   ...|:.| |.|                ..:.|...::|:|.....|       |.:.:.
  Fly   286 GGFHFKPSAGSEI-PYSQSTYYFMSHIMLVTNLQSAYSAYEKLSFPFTPLLW-------RAIGLV 342

  Fly   289 ELLTRVIPYPTLALLLLLW---------IFYEV--------LRGRW---RRHSRLQSIGWLVLAT 333
            .:|..:     |.:||:.|         .:||:        |..||   |..|||..:.||....
  Fly   343 LILACL-----LLMLLVRWRHHHELPRNPYYELLVLTMGGNLEDRWVPQRFPSRLVLLTWLFATL 402

  Fly   334 LVSSNYVGKLLNLF-----TDPP-------------SLPPVNS---LAALME-SPVRIISIR-SE 375
            ::.|.|...:..|.     .:||             .|..||.   ||:|.| .|.:::.:. ||
  Fly   403 VLRSGYQSGMYQLLRQDTQRNPPQTISEVLAQHFTIQLAEVNEARILASLPELRPEQLVYLEGSE 467

  Fly   376 YSAIEFTQRTKYSAAFHLALHASILIGLRNAFNTSY---GYTITSEKWKIYEEQQKRSSKPVFR- 436
            ..:.....:...|:|             |.|..|.|   ||.              |...|:.| 
  Fly   468 LQSFPALAQQSGSSA-------------RVAILTPYEYFGYF--------------RKVHPMSRR 505

  Fly   437 --------YSKDLCFYEMIPFGLVIPENSPHRAPLHSYTLLLRQ---AGLHDF---WVNR----- 482
                    |::.|.||.              |...|...:|.:|   |..|.|   |..:     
  Fly   506 LHLVRERIYTQQLAFYV--------------RRHSHLVGVLNKQIQHAHTHGFLEHWTRQYVSAV 556

  Fly   483 -----------GFSYMVKAGKINFTAVGERYE--------AKTLTITDLRNVFIIYVSVLLISLI 528
                       ..||....|.....::.|..|        ...|::.:|..:|.:.:...|.:::
  Fly   557 DEKDESVARIASTSYSTLDGIDGDPSLSESEEDQQVAPVRQNVLSMRELAALFWLILWANLGAVV 621

  Fly   529 LFTCELFV 536
            :|..||.:
  Fly   622 VFVLELLL 629



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.