DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and Eppin

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_083601.1 Gene:Eppin / 75526 MGIID:1922776 Length:134 Species:Mus musculus


Alignment Length:51 Identity:20/51 - (39%)
Similarity:28/51 - (54%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CSFIANPGPCKGNFEMFAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLC 75
            ||...:.|.|...|..:.::.:|:.|..||||||.||.|.||::..|...|
Mouse    77 CSLPKDSGYCMAYFRRWWFNKENSTCQVFIYGGCQGNNNNFQSQSICQNAC 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 19/49 (39%)
EppinNP_083601.1 WAP 30..72 CDD:459672
Kunitz_eppin 75..131 CDD:438654 20/51 (39%)
Interaction with SEMG1. /evidence=ECO:0000250 102..133 14/26 (54%)
Interaction with LTF. /evidence=ECO:0000250 117..133 4/11 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.