| Sequence 1: | NP_651145.2 | Gene: | CG17380 / 42766 | FlyBaseID: | FBgn0039077 | Length: | 119 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_083601.1 | Gene: | Eppin / 75526 | MGIID: | 1922776 | Length: | 134 | Species: | Mus musculus |
| Alignment Length: | 51 | Identity: | 20/51 - (39%) |
|---|---|---|---|
| Similarity: | 28/51 - (54%) | Gaps: | 0/51 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 25 CSFIANPGPCKGNFEMFAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLC 75 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17380 | NP_651145.2 | Kunitz-type | 25..75 | CDD:438633 | 19/49 (39%) |
| Eppin | NP_083601.1 | WAP | 30..72 | CDD:459672 | |
| Kunitz_eppin | 75..131 | CDD:438654 | 20/51 (39%) | ||
| Interaction with SEMG1. /evidence=ECO:0000250 | 102..133 | 14/26 (54%) | |||
| Interaction with LTF. /evidence=ECO:0000250 | 117..133 | 4/11 (36%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||