DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and spint2

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001039077.1 Gene:spint2 / 733874 XenbaseID:XB-GENE-947329 Length:394 Species:Xenopus tropicalis


Alignment Length:60 Identity:22/60 - (36%)
Similarity:34/60 - (56%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ERCSFIANPGPCKGNFEMFAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLCNALADED 82
            |.|:..:..|||:.:|..:.||:....||.|.||||.||.|.:.:.::|:..|....|:|
 Frog   266 EYCAAPSLTGPCRASFRRWYYDVTTATCVAFTYGGCRGNKNNYLSVEDCVKNCAGRLDDD 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 18/49 (37%)
spint2NP_001039077.1 MANEC 19..104 CDD:471454
Kunitz-type 117..169 CDD:444694
Kunitz-type 195..246 CDD:444694
Kunitz-type 266..318 CDD:444694 19/51 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.