DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and Wfdc8

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001400645.1 Gene:Wfdc8 / 685170 RGDID:1597713 Length:272 Species:Rattus norvegicus


Alignment Length:53 Identity:19/53 - (35%)
Similarity:26/53 - (49%) Gaps:0/53 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ERCSFIANPGPCKGNFEMFAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLC 75
            |.|...::.|.||.....:.:|...:.|..|.|.|||||.|.|.:|.:|...|
  Rat   119 EPCLLPSDAGNCKDTLTHWYFDSQKHKCRAFTYSGCGGNSNNFLSKADCRNAC 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 17/49 (35%)
Wfdc8NP_001400645.1 WAP 73..116 CDD:459672
Kunitz-type 121..171 CDD:438633 17/49 (35%)
WAP 176..216 CDD:459672
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.