| Sequence 1: | NP_651145.2 | Gene: | CG17380 / 42766 | FlyBaseID: | FBgn0039077 | Length: | 119 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001233212.2 | Gene: | Wfdc6a / 685153 | RGDID: | 1597730 | Length: | 146 | Species: | Rattus norvegicus |
| Alignment Length: | 56 | Identity: | 24/56 - (42%) |
|---|---|---|---|
| Similarity: | 34/56 - (60%) | Gaps: | 0/56 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 20 LRHERCSFIANPGPCKGNFEMFAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLC 75 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17380 | NP_651145.2 | Kunitz-type | 25..75 | CDD:438633 | 21/49 (43%) |
| Wfdc6a | NP_001233212.2 | WAP | 42..81 | CDD:459672 | |
| Kunitz_eppin | 85..141 | CDD:438654 | 22/53 (42%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||