DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and Wfdc6a

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001233212.2 Gene:Wfdc6a / 685153 RGDID:1597730 Length:146 Species:Rattus norvegicus


Alignment Length:56 Identity:24/56 - (42%)
Similarity:34/56 - (60%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LRHERCSFIANPGPCKGNFEMFAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLC 75
            ||.:.||...:.|||......:.|:.|..:|.:||||||.||||.||::..|.::|
  Rat    82 LREDICSLPQDAGPCLAYLPRWWYNEDTGLCTQFIYGGCQGNPNNFQSEGICTVVC 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 21/49 (43%)
Wfdc6aNP_001233212.2 WAP 42..81 CDD:459672
Kunitz_eppin 85..141 CDD:438654 22/53 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.