DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and Spint3

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001170872.1 Gene:Spint3 / 629747 MGIID:3651470 Length:88 Species:Mus musculus


Alignment Length:83 Identity:25/83 - (30%)
Similarity:34/83 - (40%) Gaps:16/83 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YFLIFLI-------------VPGTSTALRHERCSFIANPGPCKGNFEMFAYDMDNNVCVEFIYGG 57
            ||.:|||             ||..|..   ..|....:.|.|:..|..:.|:.....|..|.|||
Mouse     6 YFFLFLILIFCQELCAEPNNVPRKSLP---PMCILPKDIGGCRAVFVRWYYNSKTGKCEWFRYGG 67

  Fly    58 CGGNPNRFQTKKECILLC 75
            |.||.|.|.::.:|..:|
Mouse    68 CKGNENNFPSRSQCQAVC 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 16/49 (33%)
Spint3NP_001170872.1 Kunitz_actitoxin-like 31..85 CDD:438676 16/56 (29%)

Return to query results.
Submit another query.