DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and spint2

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001070718.2 Gene:spint2 / 562009 ZFINID:ZDB-GENE-061013-323 Length:431 Species:Danio rerio


Alignment Length:83 Identity:26/83 - (31%)
Similarity:41/83 - (49%) Gaps:19/83 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ERCSFIANPGPCKGNFEMFAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLCNALADEDEYLIV 87
            |:|...::.|||:.:|.||.::..:..|..||||||.||.||:.:::||:.:|:.          
Zfish   302 EKCVVPSDSGPCRASFRMFFFEASSQSCQPFIYGGCRGNLNRYGSEEECMSVCST---------- 356

  Fly    88 YTDKNEQQITDGTMSEEG 105
                     .||...|.|
Zfish   357 ---------KDGRFDEHG 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 20/49 (41%)
spint2NP_001070718.2 MANEC <56..108 CDD:471454
Kunitz-type 133..183 CDD:438633
Kunitz-type 228..276 CDD:438633
Kunitz-type 302..354 CDD:444694 21/51 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.