DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and tfpi2

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001035185.1 Gene:tfpi2 / 560339 ZFINID:ZDB-GENE-060503-38 Length:233 Species:Danio rerio


Alignment Length:51 Identity:22/51 - (43%)
Similarity:29/51 - (56%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CSFIANPGPCKGNFEMFAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLC 75
            |.|....|||:|.|..:.::|.:..|..|.||||.||.|.|:..:|||..|
Zfish    90 CRFQKKEGPCRGLFSRYFFNMTSMQCEPFTYGGCQGNENNFRNPEECIEYC 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 21/49 (43%)
tfpi2NP_001035185.1 Kunitz-type 30..80 CDD:438633
Kunitz_TFPI2_2-like 87..140 CDD:438660 21/49 (43%)
Kunitz_TFPI1_TFPI2_3-like 147..200 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.