DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and col28a1a

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001334976.1 Gene:col28a1a / 555428 ZFINID:ZDB-GENE-070705-84 Length:1170 Species:Danio rerio


Alignment Length:62 Identity:26/62 - (41%)
Similarity:34/62 - (54%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PGTSTALRHERCSFIANPGPCKGNFEMFAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLC 75
            |....:|:|..|....:||||:....|:.||...|.|.:|.||||.||.|||:|:..|...|
Zfish  1106 PHPDNSLKHVGCGQGLDPGPCREYSVMWYYDPQANACAQFWYGGCQGNSNRFETEDICKSTC 1167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 22/49 (45%)
col28a1aNP_001334976.1 vWFA_subfamily_ECM 49..214 CDD:238727
gly_rich_SclB <246..>551 CDD:468478
gly_rich_SclB <482..>766 CDD:468478
VWA 802..980 CDD:459670
Kunitz_collagen_alpha1_XXVIII 1117..1167 CDD:438671 22/49 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.