DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and Wfdc6b

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:XP_006499938.1 Gene:Wfdc6b / 433502 MGIID:3575430 Length:155 Species:Mus musculus


Alignment Length:56 Identity:24/56 - (42%)
Similarity:33/56 - (58%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LRHERCSFIANPGPCKGNFEMFAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLC 75
            |..:.||...:.|||......:.|:.|..:|:|||||||.||||.|::|..|..:|
Mouse    90 LSEDICSLPQDAGPCLAYLPRWWYNQDTKLCIEFIYGGCQGNPNNFESKAVCTSIC 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 22/49 (45%)
Wfdc6bXP_006499938.1 WAP <63..89 CDD:459672
Kunitz_eppin 93..149 CDD:438654 23/53 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.