DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and CG42827

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster


Alignment Length:56 Identity:21/56 - (37%)
Similarity:31/56 - (55%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LRHERCSFIANPGPCKGNFEMFAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLC 75
            :|.:.|...:..|.|||..:::.|:...:.|..|||..||||.|.|.||:.|:..|
  Fly    36 IRKKICLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFC 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 19/49 (39%)
CG42827NP_651142.3 Kunitz-type 41..91 CDD:438633 19/49 (39%)

Return to query results.
Submit another query.