DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and CG14298

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster


Alignment Length:52 Identity:18/52 - (34%)
Similarity:24/52 - (46%) Gaps:8/52 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GPCKGNF--------EMFAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLC 75
            |..:|||        .:..:..|..||..|.|.||.||.|||.:::.|...|
  Fly    58 GRNEGNFCSRKDQTKVVTRWYFDKGVCKPFNYKGCNGNRNRFCSQESCDARC 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 17/50 (34%)
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 13/34 (38%)

Return to query results.
Submit another query.