DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and Tfpi

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:XP_008760202.1 Gene:Tfpi / 29436 RGDID:61914 Length:306 Species:Rattus norvegicus


Alignment Length:87 Identity:32/87 - (36%)
Similarity:42/87 - (48%) Gaps:19/87 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LIFLIVP--------------GTSTALR-----HERCSFIANPGPCKGNFEMFAYDMDNNVCVEF 53
            |:..|||              .|.:.||     |..|:..|..||||.....:.::|:::.|.||
  Rat    17 LLLSIVPELLNALPEEDDDTINTDSELRPMKPLHTFCAMKAEDGPCKAMIRSYYFNMNSHQCEEF 81

  Fly    54 IYGGCGGNPNRFQTKKECILLC 75
            |||||.||.|||.|.:||...|
  Rat    82 IYGGCRGNKNRFDTLEECRKTC 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 23/49 (47%)
TfpiXP_008760202.1 Kunitz_TFPI1_1-like 50..104 CDD:438656 25/54 (46%)
Kunitz_TFPI1_2-like 120..175 CDD:438657
Kunitz_TFPI1_TFPI2_3-like 223..276 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.