DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and Wfdc8

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001263361.1 Gene:Wfdc8 / 277343 MGIID:2685552 Length:426 Species:Mus musculus


Alignment Length:53 Identity:18/53 - (33%)
Similarity:26/53 - (49%) Gaps:0/53 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ERCSFIANPGPCKGNFEMFAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLC 75
            |.|...::.|.|:.....:.:|...:.|..|:|.||.||.|.|.||.:|...|
Mouse   125 EPCMLPSDKGNCQDILTRWYFDSQKHQCRAFLYSGCRGNANNFLTKTDCRNAC 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 16/49 (33%)
Wfdc8NP_001263361.1 WAP 79..122 CDD:459672
Kunitz-type 127..177 CDD:438633 16/49 (33%)
WAP <180..222 CDD:238120
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.