DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and AMBP

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001624.1 Gene:AMBP / 259 HGNCID:453 Length:352 Species:Homo sapiens


Alignment Length:66 Identity:25/66 - (37%)
Similarity:38/66 - (57%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CSFIANPGPCKGNFEMFAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLCNALADEDEYLIVYT 89
            |:.....|||:...:::|:|.....||.|.||||.||.|:|.::|||...|....|.||.|:.::
Human   287 CNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFS 351

  Fly    90 D 90
            :
Human   352 N 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 20/49 (41%)
AMBPNP_001624.1 lipocalin_A1M-like 28..190 CDD:381193
Glycopeptide (secretory piece) 206..226
Kunitz_bikunin_1-like 229..282 CDD:438639
Kunitz_bikunin_2-like 284..338 CDD:438640 20/50 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.