DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and Ambp

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001416262.1 Gene:Ambp / 25377 RGDID:2102 Length:361 Species:Rattus norvegicus


Alignment Length:56 Identity:23/56 - (41%)
Similarity:33/56 - (58%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CSFIANPGPCKGNFEMFAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLCNALAD 80
            |:.....|||:...|::|:|.....|::||||||.||.|:|.::|||...|....|
  Rat   286 CNLPIVQGPCRAFAELWAFDAAQGKCIQFIYGGCKGNGNKFYSEKECKEYCGVPGD 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 21/49 (43%)
AmbpNP_001416262.1 None

Return to query results.
Submit another query.