DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and T21D12.7

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001343686.1 Gene:T21D12.7 / 24104914 WormBaseID:WBGene00020648 Length:661 Species:Caenorhabditis elegans


Alignment Length:39 Identity:19/39 - (48%)
Similarity:28/39 - (71%) Gaps:2/39 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AYDMDNNV--CVEFIYGGCGGNPNRFQTKKECILLCNAL 78
            ||..|:.:  |:||::.|||||.|||.:::|||..|.:|
 Worm    50 AYYFDSEIRECIEFMFEGCGGNQNRFSSRQECINGCKSL 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 17/34 (50%)
T21D12.7NP_001343686.1 Kunitz_BPTI 31..86 CDD:425421 17/35 (49%)
Kunitz_BPTI 136..189 CDD:425421
Lustrin_cystein 397..444 CDD:464222
Lustrin_cystein 508..553 CDD:464222
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.