DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and Tfpi

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_035706.1 Gene:Tfpi / 21788 MGIID:1095418 Length:306 Species:Mus musculus


Alignment Length:84 Identity:30/84 - (35%)
Similarity:39/84 - (46%) Gaps:16/84 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LIFLIVPGTSTALR----------------HERCSFIANPGPCKGNFEMFAYDMDNNVCVEFIYG 56
            |:..:||....||.                |..|:..|:.||||.....:.::|..:.|.|||||
Mouse    17 LLLSLVPEFLNALSEEADDTDSELGSMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYG 81

  Fly    57 GCGGNPNRFQTKKECILLC 75
            ||.||.|||.|.:||...|
Mouse    82 GCEGNENRFDTLEECKKTC 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 23/49 (47%)
TfpiNP_035706.1 Kunitz_TFPI1_1-like 47..101 CDD:438656 25/54 (46%)
Kunitz_TFPI1_2-like 117..172 CDD:438657
Kunitz_TFPI1_TFPI2_3-like 223..275 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.