DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and Col28a1

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001032954.1 Gene:Col28a1 / 213945 MGIID:2685312 Length:1141 Species:Mus musculus


Alignment Length:52 Identity:20/52 - (38%)
Similarity:25/52 - (48%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RCSFIANPGPCKGNFEMFAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLC 75
            ||.....||.|......:.||...|.|..|.:.||.|:.|||.::|||...|
Mouse  1087 RCEEALKPGECGDYVVRWYYDKQVNSCARFWFSGCNGSGNRFHSEKECRETC 1138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 18/49 (37%)
Col28a1NP_001032954.1 vWFA_subfamily_ECM 47..212 CDD:238727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..770
gly_rich_SclB <257..446 CDD:468478
gly_rich_SclB <363..632 CDD:468478
gly_rich_SclB <525..>773 CDD:468478
VWA 798..974 CDD:459670
Kunitz-type 1088..1138 CDD:444694 18/49 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.