DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and Spint1

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_058603.2 Gene:Spint1 / 20732 MGIID:1338033 Length:507 Species:Mus musculus


Alignment Length:85 Identity:23/85 - (27%)
Similarity:40/85 - (47%) Gaps:15/85 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CSFIANPGPCKGNFEMFAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLCNALADEDEYLIVYT 89
            |:.:.:.|.||.|...:.|:..:..|..|.||||.||.|.|:.:::|:..|..::.:|.:     
Mouse   369 CAELPDTGFCKENIPRWYYNPFSERCARFTYGGCYGNKNNFEEEQQCLESCRGISKKDVF----- 428

  Fly    90 DKNEQQITDGTMSEEGSVMT 109
                      .:..|||:.|
Mouse   429 ----------GLRREGSIPT 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 17/49 (35%)
Spint1NP_058603.2 MANEC 42..133 CDD:462186
Kunitz_HAI1_1-like 239..297 CDD:438666
LDLa 313..344 CDD:197566
Kunitz_HAI1_2-like 369..428 CDD:438667 19/58 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.