DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and ZK287.4

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001256133.1 Gene:ZK287.4 / 191282 WormBaseID:WBGene00013965 Length:1285 Species:Caenorhabditis elegans


Alignment Length:58 Identity:22/58 - (37%)
Similarity:30/58 - (51%) Gaps:10/58 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IANPGPC-----KG-----NFEMFAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLC 75
            :.:|.||     ||     ...|:.||..:..|..|:|.|.|||.|||:|.:||:..|
 Worm   251 VFDPNPCSLSPDKGFPGSVTVNMWYYDPTSTTCSPFMYLGKGGNSNRFETSEECLETC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 21/56 (38%)
ZK287.4NP_001256133.1 Lustrin_cystein 45..91 CDD:464222
Kunitz_BPTI 99..151 CDD:425421
Kunitz_conkunitzin 257..308 CDD:438636 19/50 (38%)
KU 318..368 CDD:197529
Kunitz_conkunitzin 846..896 CDD:438636
Kunitz_conkunitzin 995..1043 CDD:438636
Kunitz_conkunitzin 1054..1104 CDD:438636
Lustrin_cystein 1148..1189 CDD:464222
KU <1215..1259 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.