DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and W05B2.2

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_499406.2 Gene:W05B2.2 / 189208 WormBaseID:WBGene00012271 Length:1278 Species:Caenorhabditis elegans


Alignment Length:94 Identity:27/94 - (28%)
Similarity:38/94 - (40%) Gaps:18/94 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TALRHERC---SFIANPGPCKG------NFEMFAYDMDNNVCVEFIYGGCGGNPNRFQTKKECIL 73
            |...|..|   ....|.|...|      ..:.:.||..:|.|.:|.|.||.||.|.|.|:.:||.
 Worm   494 TGTMHACCPSRELTCNQGLQVGTTCGLSTLQRWYYDPLHNRCNQFEYQGCNGNDNNFVTRVDCIE 558

  Fly    74 LC---------NALADEDEYLIVYTDKNE 93
            .|         :||.|.....|:..::|:
 Worm   559 TCHRSDCPDGGDALIDSSNGRIIACERND 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 19/58 (33%)
W05B2.2NP_499406.2 EB 67..118 CDD:460294
Kunitz_conkunitzin 191..247 CDD:438636
KU 305..355 CDD:197529
Kunitz_conkunitzin 508..560 CDD:438636 18/51 (35%)
KU 613..665 CDD:197529
Lustrin_cystein 719..764 CDD:464222
EB 1210..1262 CDD:460294
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.