| Sequence 1: | NP_651145.2 | Gene: | CG17380 / 42766 | FlyBaseID: | FBgn0039077 | Length: | 119 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_499892.1 | Gene: | T21D12.12 / 188695 | WormBaseID: | WBGene00020651 | Length: | 183 | Species: | Caenorhabditis elegans |
| Alignment Length: | 54 | Identity: | 21/54 - (38%) |
|---|---|---|---|
| Similarity: | 27/54 - (50%) | Gaps: | 1/54 - (1%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 30 NPGPCKGNFEMFAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLC-NALADED 82 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17380 | NP_651145.2 | Kunitz-type | 25..75 | CDD:438633 | 16/44 (36%) |
| T21D12.12 | NP_499892.1 | Kunitz_BPTI | 23..77 | CDD:425421 | 16/45 (36%) |
| KU | 127..182 | CDD:197529 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||