DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and K11D12.6

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_504350.1 Gene:K11D12.6 / 187293 WormBaseID:WBGene00019646 Length:186 Species:Caenorhabditis elegans


Alignment Length:74 Identity:24/74 - (32%)
Similarity:31/74 - (41%) Gaps:8/74 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LIFLIVP---GTSTALRHERCSFIANPGPCK-GNFEMFAYDMDNNV--CVEFIYGGCGGNPNRFQ 66
            :|.|::|   |.|.:  ...|....:.|..| .|.....|..|..|  |:.|.|.|||||.|.|.
 Worm     1 MILLLLPFLFGASVS--QNICDSPVDLGTAKCSNTSSIRYHYDPTVKRCLPFGYTGCGGNENNFA 63

  Fly    67 TKKECILLC 75
            ..:.|...|
 Worm    64 DPRICRQRC 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 18/52 (35%)
K11D12.6NP_504350.1 Kunitz_BPTI 18..72 CDD:425421 18/53 (34%)

Return to query results.
Submit another query.