DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and piit-1

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_505943.2 Gene:piit-1 / 185259 WormBaseID:WBGene00009384 Length:200 Species:Caenorhabditis elegans


Alignment Length:44 Identity:21/44 - (47%)
Similarity:24/44 - (54%) Gaps:1/44 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 MFAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLC-NALADED 82
            ||.|......|..|:|.|||||.|||.:.:||...| ||.|..|
 Worm    42 MFYYLPRLGTCQPFMYQGCGGNSNRFSSAQECRSACTNAQAQRD 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 16/34 (47%)
piit-1NP_505943.2 Kunitz_BPTI 24..77 CDD:425421 16/34 (47%)
KU 137..192 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.