DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and B0222.5

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_505373.1 Gene:B0222.5 / 181860 WormBaseID:WBGene00015056 Length:369 Species:Caenorhabditis elegans


Alignment Length:54 Identity:19/54 - (35%)
Similarity:25/54 - (46%) Gaps:3/54 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CSFIANPG-PCKGNFEMFAY--DMDNNVCVEFIYGGCGGNPNRFQTKKECILLC 75
            |:...|.| .|..|.....|  |::...|..|.:.|||||.|.::|..||...|
 Worm   188 CASNRNAGHTCNQNKTSIRYWFDVETFQCFPFEHKGCGGNQNSYRTSSECYFDC 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 18/52 (35%)
B0222.5NP_505373.1 TY 22..84 CDD:238114
TY 87..154 CDD:238114
KU 186..241 CDD:197529 18/52 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.