DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and C34F6.1

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_509868.1 Gene:C34F6.1 / 181306 WormBaseID:WBGene00007938 Length:1043 Species:Caenorhabditis elegans


Alignment Length:52 Identity:21/52 - (40%)
Similarity:29/52 - (55%) Gaps:2/52 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CSFIANPGPCKGNFE-MFAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLC 75
            |....:.||| .||| .:.||.:.:.|||:.||||.|..|.|.:.:.|..:|
 Worm   983 CLSARDSGPC-NNFEKRYGYDANTDTCVEYQYGGCEGTLNNFHSLQRCTEIC 1033

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 20/50 (40%)
C34F6.1NP_509868.1 Lustrin_cystein 185..231 CDD:464222
Kunitz_conkunitzin 239..289 CDD:438636
Lustrin_cystein 304..343 CDD:464222
Kunitz_conkunitzin 352..402 CDD:438636
Kunitz_conkunitzin 457..511 CDD:438636
Kunitz_conkunitzin 566..616 CDD:438636
Lustrin_cystein 622..663 CDD:464222
Kunitz_conkunitzin 669..719 CDD:438636
Lustrin_cystein 725..767 CDD:464222
Kunitz_conkunitzin 773..823 CDD:438636
Lustrin_cystein 828..873 CDD:464222
Kunitz_conkunitzin 880..930 CDD:438636
Kunitz_BPTI 982..1033 CDD:425421 20/50 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.