DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and C02F12.5

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_508632.2 Gene:C02F12.5 / 180656 WormBaseID:WBGene00015355 Length:176 Species:Caenorhabditis elegans


Alignment Length:39 Identity:13/39 - (33%)
Similarity:19/39 - (48%) Gaps:1/39 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 YDMDNNVCVEFIYGGCGGNPNRFQTKKECILLCNALADE 81
            ||.....|..:.|.|||...|.|::.:.|:..|.. ||:
 Worm    42 YDSKLLFCYPYKYLGCGEGSNSFESNENCLESCKP-ADQ 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 10/31 (32%)
C02F12.5NP_508632.2 KU <34..74 CDD:197529 10/31 (32%)

Return to query results.
Submit another query.