DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and mlt-11

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001256938.1 Gene:mlt-11 / 180352 WormBaseID:WBGene00012186 Length:3129 Species:Caenorhabditis elegans


Alignment Length:56 Identity:20/56 - (35%)
Similarity:36/56 - (64%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TSTALRHERCSFIANPGPCKGNFEMFAYDMDNNVCVEFIYGGCGGNPNRFQTKKEC 71
            :|..:..:.|..::.||||.|:|:.:.|:.|:..|.:|.|.|||||.|.:::::.|
 Worm   414 SSRTVNTKECVGVSLPGPCHGSFQRYFYNEDSQKCEQFTYSGCGGNGNNYESREAC 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 19/47 (40%)
mlt-11NP_001256938.1 TY <361..409 CDD:238114
Kunitz-type 429..473 CDD:438633 18/41 (44%)
Kunitz_BPTI 538..590 CDD:425421
Kunitz-type 737..787 CDD:438633
Kunitz_BPTI 803..855 CDD:425421
Kunitz_BPTI 865..917 CDD:425421
Kunitz-type 1083..1133 CDD:438633
Kunitz_BPTI 2176..2228 CDD:425421
Kunitz_ixolaris_2 2241..2291 CDD:438669
Kunitz_BPTI 2742..2793 CDD:425421
Lustrin_cystein 2910..2956 CDD:464222
Kunitz_BPTI 3070..3128 CDD:425421
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.