DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and F22E12.1

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_505684.2 Gene:F22E12.1 / 179460 WormBaseID:WBGene00009058 Length:763 Species:Caenorhabditis elegans


Alignment Length:95 Identity:27/95 - (28%)
Similarity:45/95 - (47%) Gaps:22/95 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LRHERCSFIANPGPCKGNFEM-FAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLC-------- 75
            |.:.:|:...:.|.|:.:|.: :.||..::.|..|.||||.||.|||.:.:||...|        
 Worm    20 LSNPKCNHWPDRGTCELDFHVKWYYDRYDHRCRRFFYGGCEGNENRFDSLEECSSQCHYQVPTNR 84

  Fly    76 ----------NALADEDEYLIVYTDKNEQQ 95
                      |..||.:.:   :.|:|::|
 Worm    85 DRCFQPHDPGNCYADIERW---FFDENKKQ 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 19/50 (38%)
F22E12.1NP_505684.2 Kunitz-type 25..76 CDD:438633 19/50 (38%)
KU 85..137 CDD:197529 6/30 (20%)

Return to query results.
Submit another query.