DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and C49H3.16

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001255308.1 Gene:C49H3.16 / 13196868 WormBaseID:WBGene00219436 Length:206 Species:Caenorhabditis elegans


Alignment Length:52 Identity:19/52 - (36%)
Similarity:26/52 - (50%) Gaps:1/52 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CSFIANPGPCKGNFEMFAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLCN 76
            ||.....|.|.....|:.||.::..|..|.:.|| ||.|||.:|.:|...|:
 Worm   147 CSLPPVTGSCSRARIMWYYDNESRRCERFSWSGC-GNQNRFASKMQCEQTCS 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 18/49 (37%)
C49H3.16NP_001255308.1 PHA03247 <31..126 CDD:223021
PRK10856 <60..>106 CDD:236776
Kunitz-type 147..196 CDD:438633 18/49 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.