DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17380 and LOC100535278

DIOPT Version :10

Sequence 1:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster
Sequence 2:XP_073776398.1 Gene:LOC100535278 / 100535278 -ID:- Length:2774 Species:Danio rerio


Alignment Length:52 Identity:23/52 - (44%)
Similarity:33/52 - (63%) Gaps:2/52 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CSFIANPGPCKGNFEM-FAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLC 75
            |...:|.|.| .||.: :|::..|..||:|.||||.||.|||.|:::|.:.|
Zfish  2711 CQLESNAGSC-SNFTLKWAFNSRNGQCVQFWYGGCEGNDNRFNTQEDCEIRC 2761

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 22/50 (44%)
LOC100535278XP_073776398.1 None

Return to query results.
Submit another query.