DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94e and Ir87a

DIOPT Version :9

Sequence 1:NP_001097885.2 Gene:Ir94e / 42765 FlyBaseID:FBgn0259194 Length:611 Species:Drosophila melanogaster
Sequence 2:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster


Alignment Length:359 Identity:74/359 - (20%)
Similarity:135/359 - (37%) Gaps:62/359 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 PTIPPF-GFSYPYEQ--MNWCVMLPVEADVPPFEYYTRVFEL-AAFLLTLGTLVLISCLLASALS 339
            |:|..| ..|.||.|  :.|||.......  .|..:...|.. |.||:   .:.:::|.|...| 
  Fly   460 PSISQFVSSSIPYHQDELTWCVARAKRRH--GFFNFVATFNADAGFLI---GIFVVTCSLVVWL- 518

  Fly   340 LHGYATNISEFLLHD------SCLR--GVLGQSFVEVFRAPTLVRGIYLEICVLGILITAWYNSY 396
                |..:|.|.|.:      :|||  |:|....:.....|..:|.::....::|...:..|.|:
  Fly   519 ----AQRVSGFQLRNLNGYFPTCLRVLGILLNQAIPAQDFPITLRQLFALSFLMGFFFSNTYQSF 579

  Fly   397 FSSYVTSAPKQPPFRTYDDILASKLKVVAWKPEYAELVGRLLEFRKYETMFLVEPDFNRYLALRD 461
            ..|.:|:........|..:|.::|:.|:. ..|:...:.:..|..||     :...|.....|.|
  Fly   580 LISTLTTPRSSYQIHTLQEIYSNKMTVMG-TSEHVRHLNKDGEIFKY-----IREKFQMCYNLVD 638

  Fly   462 TLDTRYGYMITTNRWVLIN-EQQKVFSRPLFQKRDDFCFFNN-----------IPFGFPLHENSV 514
            .|:.     ...|..:.:. .:|..|..|..|:...:||...           :|..:.|     
  Fly   639 CLND-----AAQNEHIAVAVSRQHSFYNPRIQRDRLYCFDRRESLYVYLVTMLLPKKYHL----- 693

  Fly   515 FMEPVQKLIMELAETGLYYHWITTGFSELIDAGEMHFVDLSPHRE--FRAMQIQDLQYVWYGYAF 577
             :..:..:|..:.|:|....|     :..:|...|...:::..||  |:|:.....:........
  Fly   694 -LHQINPVIQHIIESGHMQKW-----ARDLDMRRMIHEEITRVREDPFKALTFDQFRGAIAFSGG 752

  Fly   578 MVVLSSLVWLLENLAYTVKSKTIFPTHFMQRNKK 611
            :::::|.|:..| |.|.   |.::.|...:|..|
  Fly   753 LLLVASCVFAFE-LCYV---KYVYRTEKRERKTK 782

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94eNP_001097885.2 None
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360 6/14 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.