| Sequence 1: | NP_001287483.1 | Gene: | CG4393 / 42764 | FlyBaseID: | FBgn0039075 | Length: | 1325 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_190975.2 | Gene: | AT3G54070 / 824574 | AraportID: | AT3G54070 | Length: | 256 | Species: | Arabidopsis thaliana |
| Alignment Length: | 215 | Identity: | 59/215 - (27%) |
|---|---|---|---|
| Similarity: | 91/215 - (42%) | Gaps: | 44/215 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 22 VLTQKAKRAGPLASLRRGTGVNVQDSGGYS-ALHHACLNGHEDIVRLLLAHEASP--NLPDSRGS 83
Fly 84 SPLHLAAWAGETEIVRLLLTHPYR--PASANLQTIEQETPLHCAAQHGHTGALALLLHHDADPNM 146
Fly 147 RNSRGETPLDL------AAQYGRLQAVQMLIRAHPELIAHLGTEALERGTPSPSSPASPSRAIFP 205
Fly 206 HT--CLHLASRN----GHKS 219 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4393 | NP_001287483.1 | Ank_2 | <10..79 | CDD:289560 | 23/59 (39%) |
| ANK | 43..171 | CDD:238125 | 40/138 (29%) | ||
| ANK repeat | 49..79 | CDD:293786 | 12/32 (38%) | ||
| Ank_2 | 53..148 | CDD:289560 | 31/98 (32%) | ||
| ANK repeat | 81..115 | CDD:293786 | 11/35 (31%) | ||
| ANK | 112..257 | CDD:238125 | 26/120 (22%) | ||
| ANK repeat | 117..148 | CDD:293786 | 8/30 (27%) | ||
| Ank_2 | 122..233 | CDD:289560 | 22/110 (20%) | ||
| ANK repeat | 181..233 | CDD:293786 | 9/45 (20%) | ||
| Ank_5 | 224..276 | CDD:290568 | |||
| ANK repeat | 237..267 | CDD:293786 | |||
| SAM_AIDA1AB-like_repeat2 | 1005..1069 | CDD:188899 | |||
| SAM | 1009..1075 | CDD:197735 | |||
| PTB_Anks | 1161..1305 | CDD:269972 | |||
| AT3G54070 | NP_190975.2 | None | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D549581at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.010 | |||||