DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4393 and anks1b

DIOPT Version :9

Sequence 1:NP_001287483.1 Gene:CG4393 / 42764 FlyBaseID:FBgn0039075 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_031754554.1 Gene:anks1b / 108646221 XenbaseID:XB-GENE-947075 Length:294 Species:Xenopus tropicalis


Alignment Length:202 Identity:83/202 - (41%)
Similarity:116/202 - (57%) Gaps:38/202 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1141 ALQIRAPSELLLGLPANLRTTEWRHSAQTLLNEHINYE--------------------------- 1178
            ::.:|||:|....:|...    |:|..:.|:.:..:|:                           
 Frog    43 SISLRAPNETTGSIPFQY----WQHHPEKLIFQACDYKAYSMPFGGKYRPIVNPVPHPQCSWSVM 103

  Fly  1179 VQYLGSTVVKELRGTESTKKSIQKLKTSADGEVKSGSPLSLAICHRGVEFKDVNSKRTICEHEIQ 1243
            .:||||.::|||||||||:.:..|::.|.: ::|....:.|.:.::||:|.|..:|..|.||||:
 Frog   104 TKYLGSMLIKELRGTESTQDACSKMRKSTE-QMKKVPTIILTVSYKGVKFVDAVNKSMIAEHEIR 167

  Fly  1244 NINCACQDSEDLRHFAYITKE--QDLHYCHVFLVESTDLASEIILTLGQAFEVAYQLAL--RDG- 1303
            ||:||.||.|||..||||||:  .:|||||||.....:||.||||||||||||||||||  |.| 
 Frog   168 NISCAAQDPEDLSTFAYITKDLKSNLHYCHVFTAFDVNLAYEIILTLGQAFEVAYQLALQARKGG 232

  Fly  1304 -ITTTPE 1309
             .:|.||
 Frog   233 HSSTLPE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4393NP_001287483.1 Ank_2 <10..79 CDD:289560
ANK 43..171 CDD:238125
ANK repeat 49..79 CDD:293786
Ank_2 53..148 CDD:289560
ANK repeat 81..115 CDD:293786
ANK 112..257 CDD:238125
ANK repeat 117..148 CDD:293786
Ank_2 122..233 CDD:289560
ANK repeat 181..233 CDD:293786
Ank_5 224..276 CDD:290568
ANK repeat 237..267 CDD:293786
SAM_AIDA1AB-like_repeat2 1005..1069 CDD:188899
SAM 1009..1075 CDD:197735
PTB_Anks 1161..1305 CDD:269972 75/176 (43%)
anks1bXP_031754554.1 PTB_Anks 59..231 CDD:269972 74/176 (42%)
PRK10938 <214..>280 CDD:182852 18/26 (69%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 107 1.000 Domainoid score I6424
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003340
OrthoInspector 1 1.000 - - mtm9472
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.