Sequence 1: | NP_001287483.1 | Gene: | CG4393 / 42764 | FlyBaseID: | FBgn0039075 | Length: | 1325 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_031754554.1 | Gene: | anks1b / 108646221 | XenbaseID: | XB-GENE-947075 | Length: | 294 | Species: | Xenopus tropicalis |
Alignment Length: | 202 | Identity: | 83/202 - (41%) |
---|---|---|---|
Similarity: | 116/202 - (57%) | Gaps: | 38/202 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 1141 ALQIRAPSELLLGLPANLRTTEWRHSAQTLLNEHINYE--------------------------- 1178
Fly 1179 VQYLGSTVVKELRGTESTKKSIQKLKTSADGEVKSGSPLSLAICHRGVEFKDVNSKRTICEHEIQ 1243
Fly 1244 NINCACQDSEDLRHFAYITKE--QDLHYCHVFLVESTDLASEIILTLGQAFEVAYQLAL--RDG- 1303
Fly 1304 -ITTTPE 1309 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4393 | NP_001287483.1 | Ank_2 | <10..79 | CDD:289560 | |
ANK | 43..171 | CDD:238125 | |||
ANK repeat | 49..79 | CDD:293786 | |||
Ank_2 | 53..148 | CDD:289560 | |||
ANK repeat | 81..115 | CDD:293786 | |||
ANK | 112..257 | CDD:238125 | |||
ANK repeat | 117..148 | CDD:293786 | |||
Ank_2 | 122..233 | CDD:289560 | |||
ANK repeat | 181..233 | CDD:293786 | |||
Ank_5 | 224..276 | CDD:290568 | |||
ANK repeat | 237..267 | CDD:293786 | |||
SAM_AIDA1AB-like_repeat2 | 1005..1069 | CDD:188899 | |||
SAM | 1009..1075 | CDD:197735 | |||
PTB_Anks | 1161..1305 | CDD:269972 | 75/176 (43%) | ||
anks1b | XP_031754554.1 | PTB_Anks | 59..231 | CDD:269972 | 74/176 (42%) |
PRK10938 | <214..>280 | CDD:182852 | 18/26 (69%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 107 | 1.000 | Domainoid score | I6424 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0003340 | |
OrthoInspector | 1 | 1.000 | - | - | mtm9472 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 4.000 |