DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and Eppin

DIOPT Version :9

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_083601.1 Gene:Eppin / 75526 MGIID:1922776 Length:134 Species:Mus musculus


Alignment Length:59 Identity:22/59 - (37%)
Similarity:31/59 - (52%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NIRKKICLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFCGK 93
            |.::.||....:.|.|....:.|::|.:.|.||||||..|.||.|.|.::..|...|.|
Mouse    71 NPQQDICSLPKDSGYCMAYFRRWWFNKENSTCQVFIYGGCQGNNNNFQSQSICQNACEK 129

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 KU 40..92 CDD:238057 19/51 (37%)