DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and SPINT1

DIOPT Version :10

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_857593.1 Gene:SPINT1 / 6692 HGNCID:11246 Length:529 Species:Homo sapiens


Alignment Length:62 Identity:21/62 - (33%)
Similarity:34/62 - (54%) Gaps:6/62 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EREQYNIRKKICLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFC 91
            :.|.|      ||.|::.|:|:|....|:|:|.:..|:.|:|..|.||.|.:..:|.|:..|
Human   245 QTEDY------CLASNKVGRCRGSFPRWYYDPTEQICKSFVYGGCLGNKNNYLREEECILAC 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 Kunitz-type 41..91 CDD:438633 18/49 (37%)
SPINT1NP_857593.1 MANEC 50..139 CDD:462186
Kunitz_HAI1_1-like 245..303 CDD:438666 21/62 (34%)
LDLa 334..366 CDD:197566
Kunitz_HAI1_2-like 390..450 CDD:438667
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.