powered by:
Protein Alignment CG42827 and HHIP
DIOPT Version :9
Sequence 1: | NP_651142.3 |
Gene: | CG42827 / 42763 |
FlyBaseID: | FBgn0262009 |
Length: | 116 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_071920.1 |
Gene: | HHIP / 64399 |
HGNCID: | 14866 |
Length: | 700 |
Species: | Homo sapiens |
Alignment Length: | 120 |
Identity: | 29/120 - (24%) |
Similarity: | 40/120 - (33%) |
Gaps: | 51/120 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 RKKICLQS------------------SEYGK---------CKGRRKLWFYNPK------------ 62
|...||:| :|.|| |....:..|::|:
Human 75 RLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQSLFHSPEREVLERDLVLPL 139
Fly 63 --KSKCQVFIYSNCGGN--GNLFYTKESCVEFCGKYDWKKVRKTGLRRSADYRRK 113
|..|:.|.|: |.|: |.|..|.: |||..| .||.|.....|:.||
Human 140 LCKDYCKEFFYT-CRGHIPGFLQTTAD---EFCFYY----ARKDGGLCFPDFPRK 186
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.