DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and appa

DIOPT Version :9

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_571639.1 Gene:appa / 58083 ZFINID:ZDB-GENE-000616-13 Length:738 Species:Danio rerio


Alignment Length:98 Identity:26/98 - (26%)
Similarity:43/98 - (43%) Gaps:25/98 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DMDSD-----SLQEQYEREQ--------------------YNIRKKICLQSSEYGKCKGRRKLWF 58
            |.|.|     .::|:.|.|:                    ..:.:::|..|:|.|.|:.....|:
Zfish   246 DQDGDGDRDEKIEEEEEEEERTQSTSAALTSTTTTTTESVEEVVREVCFASAETGPCRAMLSRWY 310

  Fly    59 YNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFC 91
            |..::.:|..|||..||||.|.|.::|.|:..|
Zfish   311 YVREERRCAPFIYGGCGGNRNNFESEEYCLSVC 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 KU 40..92 CDD:238057 20/52 (38%)
appaNP_571639.1 A4_EXTRA 28..189 CDD:128326
APP_N 32..132 CDD:280358
APP_Cu_bd 134..189 CDD:289676
Kunitz_BPTI 293..343 CDD:278443 19/49 (39%)
APP_E2 349..531 CDD:289677
Beta-APP 643..681 CDD:281491
APP_amyloid 684..734 CDD:287486
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.