DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and axo

DIOPT Version :10

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_001246631.1 Gene:axo / 43923 FlyBaseID:FBgn0262870 Length:2179 Species:Drosophila melanogaster


Alignment Length:65 Identity:21/65 - (32%)
Similarity:28/65 - (43%) Gaps:10/65 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QYEREQYNIRKKICLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGN-GNLFYTKESCVEFC 91
            |||:         |....:.|.||.....|.|.|..::|..||:..|.|| .|.|.|:..|:..|
  Fly   115 QYEK---------CAGPGDPGPCKQYIYKWRYEPTTNECTNFIWGGCEGNPQNRFGTEAECLFHC 170

  Fly    92  91
              Fly   171  170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 Kunitz-type 41..91 CDD:438633 17/50 (34%)
axoNP_001246631.1 Kunitz-type 119..170 CDD:438633 17/50 (34%)
Laminin_G_2 275..413 CDD:460494
EGF_CA 433..476 CDD:238011
Laminin_G_2 514..640 CDD:460494
Laminin_G_2 698..817 CDD:460494
EGF_CA 842..878 CDD:238011
Laminin_G_2 1112..1240 CDD:460494
EGF_CA 1256..1297 CDD:238011
Laminin_G_2 1351..1503 CDD:460494
Laminin_G_2 1612..1733 CDD:460494
PHA03247 <1895..2164 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.